Thermosphaera chiliense: IMZ38_03055 Help Entry IMZ38_03055       CDS       T10865                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tcs  Thermosphaera chiliense Pathway tcs03010   Ribosome Brite KEGG Orthology (KO) [BR:tcs00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     IMZ38_03055   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     IMZ38_03055  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tcs03011]     IMZ38_03055    04121 Ubiquitin system [BR:tcs04121]     IMZ38_03055 Ribosome [BR:tcs03011]  Ribosomal proteins   Eukaryotes    Large subunit     IMZ38_03055   Archaea     IMZ38_03055 Ubiquitin system [BR:tcs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    IMZ38_03055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DUF7577 Zn_Ribbon_1 DZR Zn_ribbon_LapB Zn_ribbon_RanBP Rpr2 CpXC Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  QOR94903 UniProt:  A0A7M1UTK6 LinkDB All DBs Position 513098..513274 Genome browser AA seq 58 aa AA seqDB search MPINDPELLKIVQARVLNKMVCRRCGALNPPGATKCRRCKSKGTLRPKKAVRTATKAG NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgccgattaacgacccggagttgctgaaaatagtgcaggcaagagtcttgaacaaaatg gtctgcaggagatgcggtgctttaaaccctcccggggctacaaagtgcaggagatgcaaa tccaagggcacgctgaggccgaagaaggctgttagaacagcaactaaagcaggctaa

DBGET integrated database retrieval system