Pseudoduganella chitinolytica: PX653_03385 Help Entry PX653_03385       CDS       T08857                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tct  Pseudoduganella chitinolytica Pathway tct00998   Biosynthesis of various antibiotics tct01100   Metabolic pathways tct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tct00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PX653_03385 (acpP)    00074 Mycolic acid biosynthesis     PX653_03385 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PX653_03385 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 MAP DUF1493 Motif Other DBs NCBI-ProteinID:  WEF33839 LinkDB All DBs Position 748149..748388 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKNESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgcgttaagaagatcgtcgccgaacaactgggcgtcgccgaa gcagacatcaagaacgaatcgtccttcgtcgatgacctgggcgccgactccctcgacacc gttgagctggtcatggcactggaagacgaattcgaaatggaaatcccagacgaacaggct gaaaagatcaccacggtgcagcaagccatcgactacgcgaccgcgcacgtcaaggcctga

DBGET integrated database retrieval system