KEGG   Pseudoduganella chitinolytica: PX653_24980
Entry
PX653_24980       CDS       T08857                                 
Name
(GenBank) M56 family metallopeptidase
  KO
K02172  bla regulator protein blaR1
Organism
tct  Pseudoduganella chitinolytica
Pathway
tct01501  beta-Lactam resistance
Module
tct_M00627  beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:tct00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PX653_24980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tct01002]
    PX653_24980
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:tct01504]
    PX653_24980
Peptidases and inhibitors [BR:tct01002]
 Metallo peptidases
  Family M56
   PX653_24980
Antimicrobial resistance genes [BR:tct01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    PX653_24980
SSDB
Motif
Pfam: Peptidase_M56 TonB_C TonB_2 Peptidase_M48
Other DBs
NCBI-ProteinID: WEF32627
UniProt: A0ABY8B9L8
LinkDB
Position
complement(5599348..5600592)
AA seq 414 aa
MNALVDALGWTLVHFVWQGALIGLATAAVLALLRDATPQARYLAACTGLVLCAAWPLAQF
GLRLGGGMAELDAHPAREAAGATVRALVLQPYMAWIVAAWSVGSVALALRTALGLAWIGR
AARVGARDPAWQARLTRLAQAMGVRRAVRLRIVDGMAGPVTALWWRPVVLVPASLVSGLP
PELLHALLAHEIAHVRRHDYLVNLLQNAIETVLFYHPAVWWLSRRIRRERELIADALAAA
HAGGPRRLALALSELEKRQFTHPEPALAANGGDTMDRITRLLRPVPRRNRAASLAAALPA
LLLAGACVAGLAHANADAPVDKPEKQANIDFASCAKPAWPAQALAAKQSGTVTLRFLIER
DGSVADSQVRKSSGHPALDEAAREGIAKCRFQPASSAGKPVKAWNMMQYVWAPE
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaacgccctggtggacgccctcggctggacgctcgtccacttcgtctggcagggcgcg
ctgatcggcctggccacggctgccgtgctggcactgctgcgcgatgcgacgccgcaggca
cgctatctggcggcctgcaccggcctggtgctgtgcgcggcctggccgctggcgcaattc
ggcctgcgcctgggaggcggcatggcggaactggatgcccaccccgccagggaagccgcc
ggggccaccgtgcgcgccctggtcctgcaaccttatatggcgtggatcgtggccgcctgg
agtgtcggcagcgtggcactggcgctgcgcactgccctgggcctcgcctggatcggccgg
gccgcccgtgtcggcgcgcgcgatccggcgtggcaggcacgcctgacccggctggcccag
gccatgggtgtgcggcgcgccgtgcggttgcgcattgtcgacgggatggccgggcccgtc
acggcgctgtggtggcggcccgtggtgctggtaccggccagcctggtgtccggcctgccg
cccgagctgctgcatgccttgctggcccatgaaatcgcccacgtgcgccggcatgactac
ctcgtcaacctgctgcagaacgcgatcgagacggtgctgttctaccacccggccgtatgg
tggctgtcgcgccgcatccgccgcgaacgcgaactgatcgccgacgcgcttgccgcggcc
cacgccggcgggccgcgccggctggcactcgccctttccgaactggagaaacgccagttc
acccaccccgaaccggccctcgcggccaatggaggagacaccatggaccgaatcacccga
ctgctgcgccccgtcccacgccgcaaccgcgccgcttcccttgccgccgcattgcccgca
ctgctgctggccggcgcctgcgtggccggcctggcccacgccaacgccgatgcgccggtg
gacaagcccgagaaacaggccaacatcgacttcgcctcgtgcgccaagcccgcctggccg
gcgcaggcgttggcggcaaagcagagcgggaccgtcacgctgcgcttcctgatcgagcgc
gacggcagcgtggccgactcccaggtgcgcaagtcgagcggccatccggcactcgacgaa
gcggcccgcgagggcatcgccaagtgccgcttccagccggccagcagcgccggcaagccg
gtcaaggcgtggaacatgatgcagtacgtctgggcgccggaatga

DBGET integrated database retrieval system