KEGG   Thermomonospora curvata: Tcur_1664
Entry
Tcur_1664         CDS       T01127                                 
Name
(GenBank) peptidase U61 LD-carboxypeptidase A
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
tcu  Thermomonospora curvata
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tcu01002]
    Tcur_1664
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tcu01011]
    Tcur_1664
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     Tcur_1664
Peptidases and inhibitors [BR:tcu01002]
 Serine peptidases
  Family S66
   Tcur_1664
Peptidoglycan biosynthesis and degradation proteins [BR:tcu01011]
 Precursor biosynthesis
  Carboxypeptidase
   Tcur_1664
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: ACY97240
UniProt: D1ABK4
LinkDB
Position
complement(1936623..1937501)
AA seq 292 aa
MKLAPGDLVAIVAPSGPVGAAALRRGVAILKGWGLRVRVAPHVAAVSGYLAGPDAARAAD
FTEAWTDPRVRGVLCARGGYGAQRMLDLIDWERLRQAGPKVFVGSSDITALHAALAHHLG
QVTYFGPMPAGTALSRDRLTADTLHRALFTGLDALRAPAGEALVPGTARGVLHGGTITLL
ATSLGAPEGAPPAGDRIVFLEDVTEAPYRLDRSLTQLLRAGWFEGVTGIVLGSFVDCGPE
EELRAMLTDRLGPLGVPILWGFPAGHGPTQLTLPFGVRAELSTATATLRFFG
NT seq 879 nt   +upstreamnt  +downstreamnt
gtgaagcttgcaccgggcgacctggtcgcgatcgtggcgccgagcggccccgtgggggcg
gcggcgctgcgccgcggggtggcgatcctcaaaggctggggactgcgcgtgcgggtggcc
ccgcacgtggcggcggtctcggggtatctggccggtccggacgccgcgcgcgccgcggac
ttcaccgaggcgtggaccgacccgcgggtgcggggcgtcctgtgcgcccgcggcggctac
ggcgcccagcgcatgctcgacctgatcgactgggagcgcctgcggcaggcgggcccgaag
gtcttcgtgggctccagcgacatcaccgccctgcacgcggccctggcgcaccacctgggg
caggtgacctacttcggcccgatgccggccgggacggctctcagccgggaccggctgacc
gccgacaccctgcaccgggcgctcttcaccgggctggacgcgctgcgcgcgccggcgggc
gaggccctggtccccggcaccgcgcgcggcgtgctgcacggcgggacgatcacgctgctg
gccaccagcctgggcgcgccggagggcgctccccccgccggggaccgcatcgtcttcctg
gaggacgtcaccgaggccccctaccggctcgaccgctccctcacccagctgctgcgcgcc
ggctggttcgagggcgtgaccggcatcgtgctgggctcgttcgtcgactgcggccccgaa
gaggagctgcgcgcgatgctgacggaccgcctcggcccgctgggcgtgccgatcctgtgg
ggctttcccgcaggccacggccccacccagctgacgctgccgttcggcgtgcgagccgag
ctgtccaccgccacggcgactttgcgcttcttcggctga

DBGET integrated database retrieval system