Hydrogenovibrio crunogenus: Tcr_0713 Help Entry Tcr_0713          CDS       T00296                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tcx  Hydrogenovibrio crunogenus Pathway tcx01100   Metabolic pathways tcx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tcr_0713    00074 Mycolic acid biosynthesis     Tcr_0713   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tcr_0713 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ABB41309 UniProt:  Q31HR4 LinkDB All DBs Position 781985..782221 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVVEQLGVEEDQVTADASFIDDLGADSLDTVELVMALEEEFDCEIPDEEA EKISTLAQATSYVEANLD NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagtattgaagaacgcgtcaaaaaaattgttgttgagcaattaggtgtagaagaa gatcaagttacagctgatgcttctttcatcgatgatttaggtgcggattcactagacaca gttgaattggtaatggcattagaagaagaatttgattgtgaaatccctgatgaagaagca gagaagatttctactttagcgcaagccacttcttatgtagaagcgaacttagattaa

DBGET integrated database retrieval system