Thiomicrospira cyclica: Thicy_0257 Help Entry Thicy_0257        CDS       T01517                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism tcy  Thiomicrospira cyclica Brite KEGG Orthology (KO) [BR:tcy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tcy03110]     Thicy_0257 Chaperones and folding catalysts [BR:tcy03110]  Protein folding catalysts   Protein disulfide isomerase    Thicy_0257 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Redoxin Glrx-like Thioredoxin_4 Motif Other DBs NCBI-ProteinID:  AEG31033 UniProt:  F6D9Z6 LinkDB All DBs Position 256083..256346 Genome browser AA seq 87 aa AA seqDB search MTGLVVVYANNTCPYCSKARKLLDQKGVAYTWHNIDQIPNGWQKVKEVSGRHTIPQIFIG DHHVGGCDELYAADKSGQLDKILAKVN NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacaggcttagtggtggtttatgccaataatacctgcccatactgctctaaggcccgc aagctgctagaccaaaaaggggttgcctatacttggcataatattgaccaaatccccaac ggttggcagaaagtaaaagaggtgtcaggacgacacactattcctcaaatttttattggt gaccatcatgtgggtggttgtgacgaattatacgcggctgacaaatcgggtcagctggat aaaatattagcaaaggttaactga

DBGET integrated database retrieval system