Thiomicrospira cyclica: Thicy_1142 Help Entry Thicy_1142        CDS       T01517                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism tcy  Thiomicrospira cyclica Pathway tcy01100   Metabolic pathways tcy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Thicy_1142    00074 Mycolic acid biosynthesis     Thicy_1142   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Thicy_1142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  AEG31909 UniProt:  F6D8Q8 LinkDB All DBs Position complement(1296093..1296329) Genome browser AA seq 78 aa AA seqDB search MSSIEDRVKKIVVEQLGVEEAQVTPDASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKIATLAQAVAYINENLE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagatcgcgtaaagaaaattgtagttgaacaattgggtgttgaagag gcacaagttaccccagatgcgtcttttgttgatgacttgggtgcagactcacttgatacc gttgagttggtaatggccctagaagaagagttcgattgtgaaattccagatgaagaagct gagaaaattgctactttggcacaagctgttgcttacattaatgagaacctagaataa

DBGET integrated database retrieval system