Trachymyrmex cornetzi: 108764567 Help Entry 108764567         CDS       T11212                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism tcz  Trachymyrmex cornetzi Pathway tcz04145   Phagocytosis tcz04814   Motor proteins Brite KEGG Orthology (KO) [BR:tcz00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     108764567   09142 Cell motility    04814 Motor proteins     108764567  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tcz03037]     108764567    04812 Cytoskeleton proteins [BR:tcz04812]     108764567 Cilium and associated proteins [BR:tcz03037]  Motile cilia and associated proteins   Dynein arm    108764567 Cytoskeleton proteins [BR:tcz04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      108764567 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 DUF7917 Motif Other DBs NCBI-GeneID:  108764567 NCBI-ProteinID:  XP_018368351 UniProt:  A0A195DSP3 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search LQFVVDDVSTIIKEAIEVSIGGNTYQHNKVNQWTSNVVEACLGNLTKLQKAYKYIVTCTI MQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLAL NT seq 315 nt NT seq  +upstreamnt  +downstreamnt ttgcaatttgtggtagatgacgtgagcaccattatcaaggaagcgattgaagtgtcaata ggtggcaatacttatcagcataataaagtcaatcaatggacttcgaatgtggtagaagct tgcttgggcaatcttacaaaattacagaaggcctataaatatatcgtgacttgcacaatc atgcagaaaaatggagctggacttcataccgcaagttcatgttactgggataatgctact gatggcagttgcacagtgcgctgggaaaataaaaccatgtattgtattgtatctgttttt ggattggctctataa

DBGET integrated database retrieval system