Triticum dicoccoides (wild emmer wheat): 119266710 Help Entry 119266710         CDS       T07278                                  Name (RefSeq) probable histone H2A variant 3   KO K11251   histone H2A Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119266710  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tdc03036]     119266710   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119266710 Chromosome and associated proteins [BR:tdc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119266710 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119266710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Thymidylat_synt Motif Other DBs NCBI-GeneID:  119266710 NCBI-ProteinID:  XP_037403868 LinkDB All DBs Position 1A:202833178..202834299 Genome browser AA seq 108 aa AA seqDB search MTCLCVCTMQFPVGRIHRQLKQRVSANGRVGATAAVYSAAILEYLTAEVLELAGNASKDL KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacatgcttgtgtgtttgcactatgcagttcccggtgggacgtatacacaggcagctc aagcagagggtctcggctaatggccgtgtgggtgccactgctgctgtgtactctgcagca atccttgagtaccttactgccgaggtccttgagctggccggcaacgctagcaaggatctc aaggtgaagcgtatcacccctcgccacctgcagcttgcgatccgtggagatgaggagctg gacaccctcatcaagggcaccatcgctggtggtggtgtcatccctcacatccacaagtca ctcatcaacaagacctccaaggagtga

DBGET integrated database retrieval system