Triticum dicoccoides (wild emmer wheat): 119272353 Help Entry 119272353         CDS       T07278                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03083   Polycomb repressive complex tdc04120   Ubiquitin mediated proteolysis tdc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119272353    04120 Ubiquitin mediated proteolysis     119272353   09126 Chromosome    03083 Polycomb repressive complex     119272353  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119272353    04121 Ubiquitin system [BR:tdc04121]     119272353    03036 Chromosome and associated proteins [BR:tdc03036]     119272353 Membrane trafficking [BR:tdc04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     119272353 Ubiquitin system [BR:tdc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      119272353    Cul7 complex      119272353 Chromosome and associated proteins [BR:tdc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      119272353   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      119272353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  119272353 NCBI-ProteinID:  XP_037409755 LinkDB All DBs Position 3A:624088461..624089813 Genome browser AA seq 152 aa AA seqDB search MIMLKTSDGDEFEVEEVVAMESLTIRHMIEDECADNEILIPNVDSKILSKVIEYCYKHVH AKPCATAGGSTYVVVSDTAANATLAEDLKNWDVEFVKVNPTVLYDIILAACYLNIEALVN LISQTMTDMIKGKTTEEIRKMFNLKNDFMLEE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgatcatgctaaagacctcagatggtgatgagtttgaggtcgaggaggtggtcgccatg gagtccctgaccatccgccacatgatcgaggatgagtgcgccgacaacgagatcctaatc cccaacgtcgattccaagatcctctctaaggtcatcgagtactgctacaagcacgtccat gccaagccatgcgctaccgccggtggatccacctatgtcgttgtgtctgataccgcggct aacgccaccctagcagaggacctcaagaactgggatgtagagttcgtcaaggtcaacccg accgtcctctacgacatcatcctggctgcatgctatcttaacatcgaggcactggtgaac ctaatatcccagactatgaccgacatgatcaagggcaaaactacggaggagatacgcaag atgttcaacctgaagaacgacttcatgctcgaggagtag

DBGET integrated database retrieval system