Triticum dicoccoides (wild emmer wheat): 119273225 Help Entry 119273225         CDS       T07278                                  Name (RefSeq) putative glutaredoxin-C2   KO K03676   glutaredoxin 3 Organism tdc  Triticum dicoccoides (wild emmer wheat) Brite KEGG Orthology (KO) [BR:tdc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tdc03110]     119273225 Chaperones and folding catalysts [BR:tdc03110]  Protein folding catalysts   Protein disulfide isomerase    119273225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Motif Other DBs NCBI-GeneID:  119273225 NCBI-ProteinID:  XP_037410364 LinkDB All DBs Position 3A:698750719..698750967 Genome browser AA seq 82 aa AA seqDB search MVDRVTKLASQRVVVIFGVSNRFMCHVVKTLFTELGVSWTVHKLAKDPWGKDVERALAGM VMTLHLGGQLVPLLSQAGALWL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtggacagggtgacgaagctggcatcgcagcgcgtggtggtgatcttcggtgtgagc aaccgcttcatgtgccatgtggtgaagacgctcttcacggagctgggcgtgagctggacg gtgcacaaactggcaaaggacccctgggggaaggacgtcgagagggcgcttgctggcatg gtcatgacactgcaccttggcggccagcttgtgccgctcctcagccaggctggtgccctc tggctctga

DBGET integrated database retrieval system