Triticum dicoccoides (wild emmer wheat): 119275881 Help Entry 119275881         CDS       T07278                                  Name (RefSeq) calmodulin-3   KO K02183   calmodulin Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04016   MAPK signaling pathway - plant tdc04070   Phosphatidylinositol signaling system tdc04075   Plant hormone signal transduction tdc04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:tdc00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     119275881    04070 Phosphatidylinositol signaling system     119275881    04075 Plant hormone signal transduction     119275881  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     119275881  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tdc01009]     119275881   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119275881    03036 Chromosome and associated proteins [BR:tdc03036]     119275881   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119275881 Protein phosphatases and associated proteins [BR:tdc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      119275881 Membrane trafficking [BR:tdc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     119275881 Chromosome and associated proteins [BR:tdc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      119275881 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    119275881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen Caleosin EF-hand_EFHB_C FCaBP_EF-hand MotA_activ EF-hand_STIM1 SPEF2_C PA_Ig-like DUF6279 SurA_N_3 MecA_N Motif Other DBs NCBI-GeneID:  119275881 NCBI-ProteinID:  XP_037412708 LinkDB All DBs Position 3B:271407657..271410729 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMVREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggctttcagcctcttc gacaaggatggggacggttgcattaccaccaaggagctgggaactgtcatgcgttccctg gggcagaatcccactgaggcagagcttcaagacatgatcaatgaggtggatgctgacggc aatggaacaattgatttccctgaattcctcaaccttatggcccgcaagatgaaggacact gattctgaggaagagctcaaggaggcattccgtgtgtttgacaaggatcaaaatggtttt atctctgctgctgaactgcgccatgtcatgaccaaccttggtgagaagttgactgatgag gaggttgacgagatggtccgtgaggctgatgttgatggtgatggccagatcaactatgac gaatttgttaaagtcatgatggccaagtaa

DBGET integrated database retrieval system