Triticum dicoccoides (wild emmer wheat): 119281772 Help Entry 119281772         CDS       T07278                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03083   Polycomb repressive complex tdc04120   Ubiquitin mediated proteolysis tdc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119281772    04120 Ubiquitin mediated proteolysis     119281772   09126 Chromosome    03083 Polycomb repressive complex     119281772  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119281772    04121 Ubiquitin system [BR:tdc04121]     119281772    03036 Chromosome and associated proteins [BR:tdc03036]     119281772 Membrane trafficking [BR:tdc04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     119281772 Ubiquitin system [BR:tdc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      119281772    Cul7 complex      119281772 Chromosome and associated proteins [BR:tdc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      119281772   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      119281772 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  119281772 NCBI-ProteinID:  XP_037418106 LinkDB All DBs Position 3B:662386360..662387583 Genome browser AA seq 163 aa AA seqDB search MAAMGDTSKIKMIMLKTSDGDEFEVEEAVAMESLTIRHMIENECTDNETTIPNVDSKILS KVIEYCYKHVHAKPCATVGGATCAVASDTTAHATLPEDLKNWDAEFLKVNPTVLYDIILA ACHLNLEGLVDLISQTMTDMIKGKTTEEIRKMFNLKNDFMLEE NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atggcggccatgggagacaccagcaagatcaagatgatcatgctaaagacctcagatggc gatgagtttgaggtcgaggaggcggtcgccatggagtcgctgaccatccgccacatgatc gagaatgagtgcaccgacaacgaaaccacaatccccaatgttgattccaagatcctctcc aaggtcatcgagtactgctacaagcacgtccacgccaagccatgcgctaccgtcggtgga gccacctgtgccgttgcgtctgataccacggctcacgccaccctacccgaggacctcaag aactgggacgcagagttcctcaaggtcaacccgaccgtcctctacgacatcatcctggct gcatgccatcttaacctcgagggactggtggacctaatatcccagactatgactgacatg atcaagggaaaaactacggaggagatccgcaagatgttcaacctgaagaatgacttcatg ctcgaggagtag

DBGET integrated database retrieval system