Triticum dicoccoides (wild emmer wheat): 119284037 Help Entry 119284037         CDS       T07278                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03083   Polycomb repressive complex tdc04120   Ubiquitin mediated proteolysis tdc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119284037    04120 Ubiquitin mediated proteolysis     119284037   09126 Chromosome    03083 Polycomb repressive complex     119284037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119284037    04121 Ubiquitin system [BR:tdc04121]     119284037    03036 Chromosome and associated proteins [BR:tdc03036]     119284037 Membrane trafficking [BR:tdc04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     119284037 Ubiquitin system [BR:tdc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      119284037    Cul7 complex      119284037 Chromosome and associated proteins [BR:tdc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      119284037   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      119284037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  119284037 NCBI-ProteinID:  XP_037419237 LinkDB All DBs Position 4A:complement(670961991..670963372) Genome browser AA seq 156 aa AA seqDB search MAAAEAGDTKMIILKSSDDKEFEVEEAVAMESQTIRHMINDGCANNKILLPIINYKILSE VIEYCKKRIQAKPTTDTTTRASEAYDVVAPAGPVEDLKNWDAEFVRVNESTLFDLAVAAR YLNIKGLLDLTTETLTDMIKVKNCEKLLGRGAEDQQ NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcagccgcagaggcaggcgatactaagatgatcattctcaagagctcagatgacaag gagtttgaggtggaggaggctgtcgccatggagtcgcagaccatccgccacatgatcaat gacggctgcgccaacaacaagatcctgctccccatcatcaactacaagatcctctctgag gtcatcgagtactgcaagaagcgcatccaggctaagcccaccacagacaccaccaccaga gcttccgaagcatatgatgttgtggcacctgccggccccgtcgaggacctcaagaactgg gatgccgaatttgtcagggtcaacgagtccaccctttttgacctcgccgtggctgcaagg tatctcaacatcaagggactgctagacctgaccaccgagactcttaccgacatgataaag gtcaagaattgcgagaagcttctaggccgaggagcagaagatcagcagtga

DBGET integrated database retrieval system