Triticum dicoccoides (wild emmer wheat): 119286187 Help Entry 119286187         CDS       T07278                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism tdc  Triticum dicoccoides (wild emmer wheat) Brite KEGG Orthology (KO) [BR:tdc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:tdc03041]     119286187   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tdc04052]     119286187 Spliceosome [BR:tdc03041]  Complex B   Other components    Complex B specific factors     119286187 Cytokines and neuropeptides [BR:tdc04052]  Neuropeptides   Unclassified    119286187 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  119286187 NCBI-ProteinID:  XP_037421446 LinkDB All DBs Position 4A:complement(463791615..463793670) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYTIYKDHITLGDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgaccgcctggggaagaaggtgcgcgtcaagtgcaacgag gacgacaccatcggcgacctcaagaagctcgtggcggcgcagaccgggaccagggccgag aagatccgcatccagaagtggtacaccatctacaaggaccacatcaccctcggcgactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system