Triticum dicoccoides (wild emmer wheat): 119286834 Help Entry 119286834         CDS       T07278                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04145   Phagosome tdc04148   Efferocytosis tdc04517   IgSF CAM signaling tdc04518   Integrin signaling tdc04620   Toll-like receptor signaling pathway tdc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tdc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     119286834    04518 Integrin signaling     119286834  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119286834    04148 Efferocytosis     119286834  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119286834  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119286834  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119286834   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119286834    04031 GTP-binding proteins [BR:tdc04031]     119286834 Membrane trafficking [BR:tdc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119286834  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119286834   Macropinocytosis    Ras GTPases     119286834  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119286834 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119286834   Exosomal proteins of other body fluids (saliva and urine)    119286834   Exosomal proteins of colorectal cancer cells    119286834   Exosomal proteins of bladder cancer cells    119286834 GTP-binding proteins [BR:tdc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119286834 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Gtr1_RagA B12-binding Motif Other DBs NCBI-GeneID:  119286834 NCBI-ProteinID:  XP_037422202 LinkDB All DBs Position 1A:536789222..536791326 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNRFPSDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISSASYENVLKKWMPELRRFAPNVPIVLVGTKL DLRDHRAYLADHPGASAITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP PRRREVMAARKKTRRSSGCSIMHLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacggtgggggacggcgccgtcggcaagacc tgcatgctcatctgctacaccagcaacaggttccccagcgattacatccccaccgtgttc gacaacttcagcgccaacgtctccgtcgacggcaacatcgtcaacctcggcctgtgggac accgccgggcaagaggactacagcaggctgaggccgctgagctacagaggcgccgacgtc ttcgtgctcgccttctccctcatcagcagcgcaagctacgagaatgtcctcaagaagtgg atgccagagctccgccggttcgcgcccaacgtccccattgttcttgttgggaccaagcta gatctgcgtgaccacagagcctacctcgccgaccatcccggtgcctcggcaatcacaacc gcacagggtgaagaactcaggaagcagatcggcgccgcagcgtacatcgagtgtagctca aagacacagcagaacgtcaaggctgtcttcgacaccgccatcaaggtggtccttcagccg ccgaggaggagggaggtgatggcggccaggaagaaaactaggcgaagctctggatgctcc atcatgcacttgatgtgtggcagcacgtgtgctgcctga

DBGET integrated database retrieval system