Triticum dicoccoides (wild emmer wheat): 119295386 Help Entry 119295386         CDS       T07278                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03018   RNA degradation tdc03040   Spliceosome Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     119295386   09123 Folding, sorting and degradation    03018 RNA degradation     119295386  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tdc03019]     119295386    03041 Spliceosome [BR:tdc03041]     119295386 Messenger RNA biogenesis [BR:tdc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      119295386   mRNA degradation factors    5'-3' decay     Lsm complex      119295386 Spliceosome [BR:tdc03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     119295386 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM TSNR_N Motif Other DBs NCBI-GeneID:  119295386 NCBI-ProteinID:  XP_037429704 LinkDB All DBs Position 1A:607282025..607289349 Genome browser AA seq 99 aa AA seqDB search MASVGPTLESLVDQVISIITNDGRNIVGTLRGFDQATNIILDESHERVYSTKEGVQQLVL GLYIIRGDNIGVVGEVDEELDAALDMSKLRAQPLKPVIH NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgtggggccgacgctcgagtccctcgtcgaccaggtgatctccatcatcacc aacgacggccgcaacatcgtggggactctgcgcgggttcgaccaggccaccaacataatc ctcgacgagtcccacgagagggtctactccactaaggagggagtacagcagcttgtcctt ggtctgtacatcatcaggggtgataacataggcgtggtgggtgaggtggacgaggagctg gacgcggcgctggacatgtcgaagctgagagcgcagcccctcaagccagtcatccactga

DBGET integrated database retrieval system