Triticum dicoccoides (wild emmer wheat): 119295699 Help Entry 119295699         CDS       T07278                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119295699  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tdc04121]     119295699    03400 DNA repair and recombination proteins [BR:tdc03400]     119295699 Ubiquitin system [BR:tdc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119295699    Cul5 complex      119295699 DNA repair and recombination proteins [BR:tdc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119295699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  119295699 NCBI-ProteinID:  XP_037430043 LinkDB All DBs Position 4B:183685447..183688857 Genome browser AA seq 120 aa AA seqDB search MVGKGGEAAASAQHKEEHEEDGDMVGVVKLISAEGFEFVIDKKAAMVSNTLRNMLTSPGG FAETREGEVRFPEISTAILEKICQYFYWSLHYASGKETAEFPIEPEITLELMMAANYLDT NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggtggggaaaggaggcgaggccgcggcgtcggcgcagcacaaggaggagcatgaggaa gatggcgacatggttggcgtggtgaagctgatcagcgccgagggtttcgagttcgtcatc gacaagaaggcggccatggtctccaacaccctccggaacatgctcacctcacctggtggt ttcgcggagacgcgcgagggcgaggtgaggttcccggagatcagcaccgcgatcctagag aagatctgccagtacttctactggtcgctccactacgccagtgggaaggagacggcggag ttcccgatcgagccagaaataacgctggagctgatgatggctgcaaactacctcgacact tag

DBGET integrated database retrieval system