Triticum dicoccoides (wild emmer wheat): 119306003
Help
Entry
119306003 CDS
T07278
Name
(RefSeq) SKP1-like protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
tdc
Triticum dicoccoides (wild emmer wheat)
Pathway
tdc03083
Polycomb repressive complex
tdc04120
Ubiquitin mediated proteolysis
tdc04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
tdc00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
119306003
04120 Ubiquitin mediated proteolysis
119306003
09126 Chromosome
03083 Polycomb repressive complex
119306003
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
tdc04131
]
119306003
04121 Ubiquitin system [BR:
tdc04121
]
119306003
03036 Chromosome and associated proteins [BR:
tdc03036
]
119306003
Membrane trafficking [BR:
tdc04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
119306003
Ubiquitin system [BR:
tdc04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
119306003
Cul7 complex
119306003
Chromosome and associated proteins [BR:
tdc03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
119306003
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
119306003
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
YpjP
Motif
Other DBs
NCBI-GeneID:
119306003
NCBI-ProteinID:
XP_037438261
LinkDB
All DBs
Position
5B:complement(528433616..528436313)
Genome browser
AA seq
161 aa
AA seq
DB search
MAAAAAVAPEKKLTLRSSDGMEFVVEEMVAMESQAIKHMIEDDCANNIIPLPNVKAEILA
MVIKYCKQHVEKHGAEATDSTTKASERYLKTFDKDFVDVEQRILFDLILAANYLDIKGLL
DLTCQKAADMIKGLTPEEIRRTFNIKNDLTKEEVDELWMKN
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
atggcggccgcggcagcagtggcaccggagaagaagctcacgctgaggagctccgacggc
atggagtttgtggtggaggagatggtggcgatggagtcacaggccatcaagcacatgatc
gaggatgactgcgccaacaacatcatccccctccccaatgtcaaagcagagatccttgcc
atggtcatcaaatactgcaagcagcacgtggagaagcacggagccgaagccacagactcc
accaccaaggcctccgagcggtacctcaagaccttcgacaaggatttcgtcgacgtcgaa
caacgcatcctcttcgacctcatcttggctgcaaactacctggacatcaaggggttgctg
gatctgacctgccagaaggccgctgacatgataaaggggctgactccagaggagatccgc
aggaccttcaacatcaagaacgacctcaccaaagaggaagtggatgaactctggatgaag
aactag
DBGET
integrated database retrieval system