Triticum dicoccoides (wild emmer wheat): 119314547 Help Entry 119314547         CDS       T07278                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04145   Phagosome tdc04148   Efferocytosis tdc04620   Toll-like receptor signaling pathway tdc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tdc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119314547    04148 Efferocytosis     119314547  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119314547  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119314547  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119314547   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119314547    04031 GTP-binding proteins [BR:tdc04031]     119314547 Membrane trafficking [BR:tdc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119314547  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119314547   Macropinocytosis    Ras GTPases     119314547  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119314547 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119314547   Exosomal proteins of other body fluids (saliva and urine)    119314547   Exosomal proteins of colorectal cancer cells    119314547   Exosomal proteins of bladder cancer cells    119314547 GTP-binding proteins [BR:tdc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119314547 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  119314547 NCBI-ProteinID:  XP_037445150 LinkDB All DBs Position 6A:42181781..42185070 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPYYIECSSKTQLNVKGVFDAAIKVVLAP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcaccgtgggggacggcgccgtcggcaagact tgcatgctcatctcctacacctccaacaccttccccaccgactatgtgccaacggtgttt gacaacttcagtgctaatgttgtggttgatggcaacactgtcaacctcgggctatgggat actgcaggtcaggaggactacaacagactgagaccgctgagttatcgtggagctgatgtc ttccttctggccttctcacttatcagcaaggccagctatgagaatgtttcaaagaagtgg atacctgagctgaagcattatgcaccaggtgtgcctattatcctcgtgggaacaaagctt gatcttcgagatgacaagcagttctttgtggaccatcctggtgctgttcctatcactact gctcagggggaggaactaaaaaagttaataggcgcaccctactacatcgaatgcagctcg aagacccaactaaatgtcaagggtgtatttgatgcggcaataaaggtggtacttgcgcca ccaaaggcgaagaagaagaaaaaggcgcagaggggggcttgctccatcttgtga

DBGET integrated database retrieval system