Triticum dicoccoides (wild emmer wheat): 119318904
Help
Entry
119318904 CDS
T07278
Name
(RefSeq) tubby-like protein 4
KO
K19600
tubby and related proteins
Organism
tdc
Triticum dicoccoides (wild emmer wheat)
Brite
KEGG Orthology (KO) [BR:
tdc00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
tdc03037
]
119318904
04990 Domain-containing proteins not elsewhere classified [BR:
tdc04990
]
119318904
Cilium and associated proteins [BR:
tdc03037
]
Primary cilia and associated proteins
Other primary cilia associated proteins
119318904
Domain-containing proteins not elsewhere classified [BR:
tdc04990
]
Other domain-containing proteins
Tubby family proteins
119318904
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tub
DUF3527
Motif
Other DBs
NCBI-GeneID:
119318904
NCBI-ProteinID:
XP_037449360
LinkDB
All DBs
Position
6A:137259146..137261411
Genome browser
AA seq
397 aa
AA seq
DB search
MAATPPKREPLAPLSCNAAADTPAATAGARPRAPAVSAEKENLGAANLGPGKEEKRATTP
AAAKAAPLKPSSLQARMEGEEAPSATATATAAGLPVFVGPRGRELLPPPPPPASSSYEAW
DLSDNEAAPAASWATLPNRALLCRPLPLDVGRCTCVVVREKATGARGVALYSLYTNEGQG
RQDRKLAVARHRRRRGRSEFIVAQNQDGVFCSSDKNFLGTMGANLVGSKYQIWGQGDRVD
ELKSQSKRLLGVIAFAPTITTLTGSFRSMRAWIPKNQSMQLRTNSSAQIQHVSGLPKDWQ
EKRSRAEQLCSRSPFYNNMTKRYELDFRERVGRMGYKVQTSVKNFQMTLEENGRQTILQL
GRVGKSKYIMDFRYPLTGYQAFCICLASMDSKLCCTL
NT seq
1194 nt
NT seq
+upstream
nt +downstream
nt
atggcagccacgccgcccaagagggagccgctggcccccctcagctgcaacgcggccgca
gacacgcctgcggccaccgccggcgcgcggccacgcgcgccggcagtctccgccgagaag
gagaacctgggcgcggccaatctcggccccggcaaggaggagaagagggcgacgacgcct
gctgccgcgaaggcggcgccgctgaagccgtcgtcgctgcaggcccgcatggagggcgag
gaggcgccgtcggcgaccgcgaccgcgacggcggcggggctgcccgtgttcgtcgggccg
agggggagggagctgctgccgccgccaccaccgccggcgtcgtcgtcctacgaggcgtgg
gacctctccgacaacgaggcggcgccggccgcgtcctgggccacgctgcccaacagggcg
ctgctgtgccgcccgctgccgctcgacgtcgggaggtgcacctgcgtcgtcgtcagggag
aaggccaccggggccagaggcgtggcgctctactcgctctacaccaacgaggggcagggg
cggcaggaccggaagctggcggtggcccggcaccggaggaggagagggaggtcggagttc
atcgtggcgcagaaccaggacggcgtcttctgcagctccgacaagaacttcctcgggact
atgggtgccaatcttgttggatccaagtaccagatttggggccagggggaccgggtcgat
gagcttaagagccagtccaagcggcttcttggcgttatcgcgtttgcccctactattact
acgctcacggggagtttcagaagcatgagggcatggatccccaagaaccagtccatgcag
ctgaggaccaacagttctgctcagattcagcacgtcagtgggcttccaaaggattggcag
gagaagaggagcagagctgagcaactctgctcaagatcacctttctacaacaatatgacg
aagcgctacgaactagatttcagagagagggttgggaggatgggatacaaggtgcagaca
tcagtgaagaacttccagatgactttggaggagaacgggaggcagacgatcttgcagctc
ggtagggtcgggaagtccaagtacataatggatttcagataccccttgactggctaccaa
gcattctgcatttgcttggcgtcgatggactccaagctgtgctgcacgctgtga
DBGET
integrated database retrieval system