Triticum dicoccoides (wild emmer wheat): 119325832 Help Entry 119325832         CDS       T07278                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04136   Autophagy - other Brite KEGG Orthology (KO) [BR:tdc00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     119325832  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119325832    04121 Ubiquitin system [BR:tdc04121]     119325832    03029 Mitochondrial biogenesis [BR:tdc03029]     119325832 Membrane trafficking [BR:tdc04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     119325832 Ubiquitin system [BR:tdc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    119325832 Mitochondrial biogenesis [BR:tdc03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     119325832 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  119325832 NCBI-ProteinID:  XP_037455454 LinkDB All DBs Position 6B:complement(641597576..641602242) Genome browser AA seq 92 aa AA seqDB search MAASEAEQKVVVHVRSAGNAPILKQDKFKISGRDKFLRVIEFLRRQLHQDTLFVYVNSSF SPSPDELIIDLYNNFAIDGKLVVNYALSAAWG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcggcctccgaggctgagcagaaagtcgtggtgcacgtccgctcggccggcaacgcg ccgatactgaagcaagacaagttcaagatttcaggacgagataaattcttgagggttatt gaatttcttcgtcgacaacttcatcaggatacactgtttgtctatgtcaacagttcgttt tctccaagcccagacgagctgataattgacttgtataataattttgcaatagacgggaag cttgtggtaaactatgctttatcggcagcgtggggttaa

DBGET integrated database retrieval system