Triticum dicoccoides (wild emmer wheat): 119328661 Help Entry 119328661         CDS       T07278                                  Name (RefSeq) polyubiquitin-like   KO K08770   ubiquitin B/C Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119328661  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tdc04121]     119328661   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119328661 Ubiquitin system [BR:tdc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    119328661 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of breast milk    119328661   Exosomal proteins of other body fluids (saliva and urine)    119328661   Exosomal proteins of colorectal cancer cells    119328661   Exosomal proteins of bladder cancer cells    119328661 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Plexin_RBD OTU1_UBXL Rad60-SLD_2 UBL_UBAC1 DUF2604 Sde2_N_Ubi_yeast Dsc3_N Ubiquitin_5 TBK1_ULD Motif Other DBs NCBI-GeneID:  119328661 NCBI-ProteinID:  XP_037457539 LinkDB All DBs Position 7A:complement(656140894..656141453) Genome browser AA seq 115 aa AA seqDB search MQIIVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLCGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgcagatcatcgtgaagactctcaccgggaagaccatcaccctggaggttgagtcctcg gacacgatcgacaacgtcaaggccaagatccaggataaggagggcgttcccccagaccag cagcgcctcatcttcgctggcaagcagctggaggacggtcgcaccctggctgactacaac atccagaaggagtccaccctccaccttgtcctccgcctctgtggtggcatgcaaatcttt gtgaagaccctcactggcaagaccatcaccttggaggtggagtcatctgacaccatcgac aacgtgaaggccaagatccaggacaaggagggcattcccccggactag

DBGET integrated database retrieval system