Triticum dicoccoides (wild emmer wheat): 119328662 Help Entry 119328662         CDS       T07278                                  Name (RefSeq) ubiquitin-like   KO K04551   ubiquitin B Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119328662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tdc04121]     119328662   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119328662 Ubiquitin system [BR:tdc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    119328662 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of breast milk    119328662   Exosomal proteins of other body fluids (saliva and urine)    119328662   Exosomal proteins of colorectal cancer cells    119328662   Exosomal proteins of bladder cancer cells    119328662 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Dsc3_N TBK1_ULD Plexin_RBD DUF2604 Rad60-SLD_2 UBL_UBAC1 OTU1_UBXL Motif Other DBs NCBI-GeneID:  119328662 NCBI-ProteinID:  XP_037457540 LinkDB All DBs Position 7A:complement(656163332..656164768) Genome browser AA seq 105 aa AA seqDB search MQIFVKSLTGKTITLEVESSDTIHNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYD IQKESTLHLVLRLRGGMQIFVKTLTDKTITLGVDVTTLIGSDQKR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagagcctcaccggcaagaccatcaccctcgaggtcgagtcctcg gacaccatccacaacgtcaaggctaagatccaggacaaggagggcatccctccggaccag cagcgtctcatctttgctggcaagcagctcgaggatggctgcaccctggctgactacgac atccagaaggagtccaccctccacttggtgctaaggctccgtggtggcatgcagatcttt gtgaagaccctcaccgacaagaccatcaccttaggggttgatgtcacgaccctcatcgga tcggaccagaagaggtag

DBGET integrated database retrieval system