Triticum dicoccoides (wild emmer wheat): 119331618 Help Entry 119331618         CDS       T07278                                  Name (RefSeq) rac-like GTP-binding protein 4   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04145   Phagosome tdc04148   Efferocytosis tdc04620   Toll-like receptor signaling pathway tdc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tdc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119331618    04148 Efferocytosis     119331618  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119331618  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119331618  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119331618   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119331618    04031 GTP-binding proteins [BR:tdc04031]     119331618 Membrane trafficking [BR:tdc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119331618  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119331618   Macropinocytosis    Ras GTPases     119331618  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119331618 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119331618   Exosomal proteins of other body fluids (saliva and urine)    119331618   Exosomal proteins of colorectal cancer cells    119331618   Exosomal proteins of bladder cancer cells    119331618 GTP-binding proteins [BR:tdc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119331618 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  119331618 NCBI-ProteinID:  XP_037460681 LinkDB All DBs Position 7A:157488910..157492224 Genome browser AA seq 213 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWLPELQHHAPSVPIVLVGT KYDLREDKQYLLDHPGVVPVTTAQGEELRKHIGATCYVECSSKTQQNVKAVFDAAIKVVI KPPTKQRERRKKKARQGCASLGVLSRRRLACFK NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctcccggttcatcaagtgcgtgacggtcggcgacggcgccgtcggc aagacctgcatgctcatctgctacaccagcaacaagttccccaccgactatgtgcccacc gtgttcgacaacttcagcgcgaacgtggtggtggacggcaccaccgtgaacctgggcctc tgggacactgcagggcaggaggattacaacagactgagaccgctgagctaccggggagcc gacgtcttcgtgctcgccttctcgctcgtcagccgcgccagctacgagaacatcatgaag aagtggctaccggagcttcagcaccatgcacccagcgtgccgatagtgctggttggtaca aaatatgatctccgcgaagacaaacaatacttacttgaccaccctggcgtggtgcctgtt actacagctcagggggaggaactccgcaagcacatcggcgcaacctgttacgtcgaatgc agctcaaagacacagcagaatgtaaaagctgtgtttgatgctgccatcaaggtagtgatc aagcctccaacaaagcagagggaacggaggaagaagaaagcacgacaaggatgtgcatca ttgggtgtcctgtctagaaggagactggcatgcttcaagtga

DBGET integrated database retrieval system