Triticum dicoccoides (wild emmer wheat): 119335817 Help Entry 119335817         CDS       T07278                                  Name (RefSeq) polyubiquitin-like   KO K04551   ubiquitin B Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119335817  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tdc04121]     119335817   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119335817 Ubiquitin system [BR:tdc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    119335817 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of breast milk    119335817   Exosomal proteins of other body fluids (saliva and urine)    119335817   Exosomal proteins of colorectal cancer cells    119335817   Exosomal proteins of bladder cancer cells    119335817 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Crinkler Motif Other DBs NCBI-GeneID:  119335817 NCBI-ProteinID:  XP_037463788 LinkDB All DBs Position 7B:2278286..2323058 Genome browser AA seq 100 aa AA seqDB search MQIFVKTVTGRTITVKVDPGDSVYVVKAKIQDQQRLMFGTEELEDGLTLADYDIEDECTL HLSKKLRPKTMQIFIKTLGGKTITVKVDPEDTVYVVKAKI NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtcaagaccgtcacgggcaggacgatcaccgtcaaggtcgatccgggg gactccgtctacgttgtcaaggcgaagattcaggatcagcagcgccttatgtttggcacg gaggagctggaggatgggttaactctggctgactacgacattgaggatgaatgcaccctt cacttatccaaaaagctcagacccaaaactatgcagatcttcatcaagaccctcggaggc aagacgatcaccgtcaaggtcgatccagaggacaccgtctacgttgtcaaggcaaagatt tag

DBGET integrated database retrieval system