KEGG   Triticum dicoccoides (wild emmer wheat): 119348169
Entry
119348169         CDS       T07278                                 

Name
(RefSeq) nicotianamine aminotransferase A-like
  KO
K14271  nicotianamine aminotransferase [EC:2.6.1.80]
Organism
tdc  Triticum dicoccoides (wild emmer wheat)
Pathway
tdc00997  Biosynthesis of various secondary metabolites - part 3
Brite
KEGG Orthology (KO) [BR:tdc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    119348169
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tdc01007]
    119348169
Enzymes [BR:tdc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.80  nicotianamine aminotransferase
     119348169
Amino acid related enzymes [BR:tdc01007]
 Aminotransferase (transaminase)
  Others
   119348169
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Glyco_hydro_20 Cys_Met_Meta_PP Aminotran_3
Other DBs
NCBI-GeneID: 119348169
NCBI-ProteinID: XP_037472385
LinkDB
Position
1B
AA seq 514 aa
MATVHQTNGAAAVNGKSKGHDEAPAANGKSNGHAEAAPANGNSNGHGEAAAANGHAEATA
NGKSNGHGEAAAANGESNGHEVAAAVAAPEEAVEWNFAGAKGGVLAATGANMSIRAIRYK
ISASVQENGPRPVLPLAHGDPSVFPAFRTAVEAEDAVAAALRTGQFNCYPAGVGLPAARS
AVAEHLSQGVPYKLSADDIFLTAGGTQAIEVIIPVLAQTAGANILLPRPGYPNYEARAAF
NKLEVRHFDLIPEKGWEVDIDSLESIADKNTTAMVIINPNNPCGSVYSYDHLAKVAEVAR
KLGILVIADEVYGKLVLGCAPFIPMGVFGHTTPVLSIGSLSKSWIVPGWRLGWVAVYDPR
KILEETKISTSITNYLNVSTDPATFIQAALPQILENTKEDFFKGIIGLLKESSEICYREI
KENKYITCPHKPEGSMFVMVKLNLHLLEEIHDDIDFCCKLAKEESVILCPGSVLGMENWV
RITFACVPTSLRDGLERIKSFCQRNKKKNLINGC
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcgaccgtacaccagaccaacggcgccgccgccgtgaacggcaagagcaagggccac
gacgaggcccccgccgcgaacggcaagagcaacggccatgccgaggccgcccccgcgaac
ggcaacagcaacggccacggcgaggccgccgccgcgaacggccatgccgaggccactgcg
aacggcaagagcaacgggcacggcgaggccgctgccgcgaacggcgagagcaacggccat
gaggtggcggcggcagtggcggcgccggaggaggcggtggagtggaatttcgcgggggcc
aagggcggcgtcctggcggcgacgggggcgaacatgagcatccgggcgatacggtacaag
atcagcgcgagcgtgcaggagaacgggccgcggcccgtgctgcccctggcccacggggac
ccgtccgttttcccggccttccgcacggccgtcgaggccgaggacgccgtcgccgccgcg
ctgcgcacggggcagttcaactgctaccccgccggcgtcggcctccccgccgcaagaagt
gccgtggcagagcacttgtcgcagggtgtgccctacaagctatcggccgacgacatcttc
ctcaccgccggtggaacccaagcgattgaggtcataatcccagttctggcccaaaccgcc
ggcgccaacattctgctccccaggccaggctatccaaactacgaggcgcgcgcggcgttc
aacaagctggaggttcgacattttgacctcatccccgagaaggggtgggaggtcgacatc
gactcgctggaatccatcgccgacaagaacacaactgcgatggtcatcataaacccaaac
aatccatgtggcagcgtttactcctacgaccatttagccaaggttgcagaggtggcaaga
aagctcggaatattggtgattgctgacgaggtatacggcaagctggttttgggctgcgcc
ccgttcatcccaatgggtgtgtttgggcacactacccctgtgttgtccatagggtctctg
tccaagtcatggatagtgcctggatggcgacttggatgggtagcggtgtacgaccccaga
aagattttagaggaaactaagatctctacatctattacgaattaccttaatgtctcaacg
gacccagcaaccttcattcaggcggctcttcctcaaattcttgagaacacaaaagaagat
ttcttcaaggggattattggtctgctaaaggaatcatcagagatatgctatagagaaata
aaggagaataaatacattacttgccctcacaagccagaaggatcgatgtttgtaatggtg
aaactgaacttgcatcttttggaggagatccatgatgatattgatttttgctgcaagctc
gcgaaagaagaatcggtgattttatgcccagggagtgttctaggaatggaaaattgggtc
cgcattacttttgcttgtgttccaacttctcttcgagatggtctcgaaaggatcaaatcc
ttctgtcaaaggaacaagaagaagaatttgattaatggttgttag

DBGET integrated database retrieval system