Triticum dicoccoides (wild emmer wheat): 119348905 Help Entry 119348905         CDS       T07278                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04145   Phagosome tdc04148   Efferocytosis tdc04620   Toll-like receptor signaling pathway tdc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tdc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119348905    04148 Efferocytosis     119348905  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119348905  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119348905  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119348905   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119348905    04031 GTP-binding proteins [BR:tdc04031]     119348905 Membrane trafficking [BR:tdc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119348905  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119348905   Macropinocytosis    Ras GTPases     119348905  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119348905 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119348905   Exosomal proteins of other body fluids (saliva and urine)    119348905   Exosomal proteins of colorectal cancer cells    119348905   Exosomal proteins of bladder cancer cells    119348905 GTP-binding proteins [BR:tdc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119348905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  119348905 NCBI-ProteinID:  XP_037472811 LinkDB All DBs Position 1B:complement(583370423..583373752) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVTKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFVDHPGAVPISTAQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVLQP PKQKRKKRKSQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttctcggttcatcaagtgcgtgacggtgggggacggcgccgtcggcaagact tgcctcctcatctcctacacatccaacaccttccccaccgactatgtcccaacagtcttc gacaacttcagcgctaacgtcgtggttgacgggagcaccgtcaacctcggattatgggat actgcaggacaagaggactataatagactacgcccactaagctaccgaggtgccgatgtc ttcctgctcgccttttctcttatcagcaaagcaagctacgagaatgtcactaagaagtgg atccctgagctacggcactacgctccgggtgtgcccataattcttgttgggacaaagctt gatctgcgggatgacgagcagtttttcgtggatcaccctggggctgttcctatttccaca gctcagggtgaagagctgaagaaggtaattggcgcgacggcctacatcgagtgcagctca aaaacacagcagaatatcaaggcggtgtttgatgcggcgatcaaggtggttctccagcct ccgaagcagaagcggaagaagaggaagtcgcagaaaggatgcagcatcttgtaa

DBGET integrated database retrieval system