Triticum dicoccoides (wild emmer wheat): 119348982 Help Entry 119348982         CDS       T07278                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc04145   Phagosome tdc04148   Efferocytosis tdc04620   Toll-like receptor signaling pathway tdc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tdc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119348982    04148 Efferocytosis     119348982  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119348982  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119348982  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdc04131]     119348982   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdc04147]     119348982    04031 GTP-binding proteins [BR:tdc04031]     119348982 Membrane trafficking [BR:tdc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119348982  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119348982   Macropinocytosis    Ras GTPases     119348982  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119348982 Exosome [BR:tdc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119348982   Exosomal proteins of other body fluids (saliva and urine)    119348982   Exosomal proteins of colorectal cancer cells    119348982   Exosomal proteins of bladder cancer cells    119348982 GTP-binding proteins [BR:tdc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119348982 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Gtr1_RagA B12-binding Motif Other DBs NCBI-GeneID:  119348982 NCBI-ProteinID:  XP_037472889 LinkDB All DBs Position 1B:596473659..596475901 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNRFPSDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISSASYENVLKKWMPELRRFAPNVPIVLVGTKL DLRDHRAYLADHPGASAITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP PRRREVMAARKKTRRSSGCSIMHLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagtttatcaagtgcgtcacggtgggcgacggcgccgtcggcaagacc tgcatgctcatctgctacaccagcaacaggttccccagcgactacatccccacggtgttc gacaacttcagcgccaacgtctccgtggacggcaacatcgtcaacctcggcctatgggac accgccgggcaagaggactacagcaggctgaggccgctgagctacagaggcgccgacgtc ttcgtgctcgccttctccctcatcagcagcgcaagctacgagaatgtcctcaagaagtgg atgccagagctccgccggttcgcgccgaacgttcccattgttcttgttgggaccaagcta gatctgcgtgaccacagagcctacctcgccgaccatcccggtgcctcagcaatcacaact gcacagggtgaagaactcaggaagcagatcggcgccgcagcttacatcgagtgcagctcg aagacgcagcagaacgtcaaggctgtcttcgacaccgccatcaaggttgtccttcaaccg ccgaggaggagggaggtgatggcggccaggaagaaaactaggcgaagctctggatgctcc atcatgcacttgatgtgtggcagcacgtgtgctgcttga

DBGET integrated database retrieval system