Triticum dicoccoides (wild emmer wheat): 119355268 Help Entry 119355268         CDS       T07278                                  Name (RefSeq) sm-like protein LSM1B   KO K12620   U6 snRNA-associated Sm-like protein LSm1 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03018   RNA degradation Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     119355268  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tdc03019]     119355268 Messenger RNA biogenesis [BR:tdc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      119355268   mRNA degradation factors    5'-3' decay     Lsm complex      119355268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Hfq Motif Other DBs NCBI-GeneID:  119355268 NCBI-ProteinID:  XP_037477951 LinkDB All DBs Position 2A:542087853..542094288 Genome browser AA seq 128 aa AA seqDB search MSWAGPDEILLSTSLAGFLDKKLIVLLRDGRKLLGTLCSFDQFANVVLQGACERVIVGEL YCDVPLGLYVIRGENVVLIGELDREKDELPSHMTCVSEAEIRTAEKAEKEARDLKGTMRK RMEFLDFD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcttgggccgggcccgacgagatcctcctctccacctccctggccggcttcttagat aaaaaacttattgtcctactacgagatggacgaaagctgcttggcactctctgctcattc gatcagtttgcaaatgttgttcttcagggtgcttgtgaacgagtaattgtgggcgaatta tattgtgatgttcctcttggtttatatgtgatccgcggagagaatgttgtattaattgga gaactggatcgcgagaaggacgaactccctagtcacatgacttgtgtttcagaggctgaa ataagaacggccgagaaagccgaaaaggaagcaagggatctgaaaggcacaatgaggaag aggatggagttcctagacttcgattag

DBGET integrated database retrieval system