Triticum dicoccoides (wild emmer wheat): 119360429 Help Entry 119360429         CDS       T07278                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03010   Ribosome tdc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     119360429   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119360429  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tdc03011]     119360429    04121 Ubiquitin system [BR:tdc04121]     119360429 Ribosome [BR:tdc03011]  Ribosomal proteins   Eukaryotes    Large subunit     119360429   Archaea     119360429 Ubiquitin system [BR:tdc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    119360429 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Dsc3_N DUF2604 Plexin_RBD UBL_UBAC1 Ubiquitin_5 OTU1_UBXL Motif Other DBs NCBI-GeneID:  119360429 NCBI-ProteinID:  XP_037481968 LinkDB All DBs Position 2B:55098139..55098525 Genome browser AA seq 94 aa AA seqDB search MWEILVSDDDAGRVIGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLADYNIQKEPTLHLVLRLRGGIIEPSLQALARN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtgggagatcctcgtctccgatgacgacgccggccgcgtcatcggcaagaccatcacg ctcgaggtcgagagtagcgacaccatcgacaatgtcaaggccaagatccaggacaaggag gggatcccgccggaccagcagcggctgatcttcgcggggaagcagctggaggacgggcgc acgctggccgactacaacatccagaaggagccgacgctgcacctcgtgctccgcctgcgc gggggcatcatcgagccctcgctccaggccctcgcccgcaattag

DBGET integrated database retrieval system