KEGG   Triticum dicoccoides (wild emmer wheat): 119363036
Entry
119363036         CDS       T07278                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2-like
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
tdc  Triticum dicoccoides (wild emmer wheat)
Brite
KEGG Orthology (KO) [BR:tdc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tdc03029]
    119363036
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tdc02000]
    119363036
Mitochondrial biogenesis [BR:tdc03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    119363036
Transporters [BR:tdc02000]
 Other transporters
  Primary active transporters [TC:3]
   119363036
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 119363036
NCBI-ProteinID: XP_037484236
LinkDB
Position
2B:198175237..198179095
AA seq 227 aa
MGTPETSREPCPDRILDDVGGAFGMGAVGGSVFHFLKGTYNSPNGERLLGGAQQVRLNAP
RVGGSFAVWGGLFSAFDCTMVFVRQKEDPWNSIIAGAATGGFLSMRQGPGAAGRSALMGG
CLLALIEGAGLMLNRVLAAPQNLPPLPTDDPNLAAAMAGGGVGGFPGMPQPPVPPVEVVS
SSGGGSWFGGLFGKKEEEKKPSGSGGKSEILESFDTPSPPIPSFDLK
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggcacgccggagacctcgcgggagccgtgcccggaccgcatcctcgacgacgtgggc
ggcgcgttcgggatgggggcggtgggcggctccgtcttccatttcctcaagggcacctac
aactcgcccaacggcgagcgcctgctgggcggggcccagcaggtgcgcctcaacgcgccg
cgcgtcggcgggagcttcgccgtctggggcggcctcttctccgccttcgactgcaccatg
gtcttcgtgcgccagaaggaggacccctggaactccatcatcgccggcgccgccacgggt
ggcttcctctccatgcgccagggccccggcgccgccggccgctccgcgctcatgggcggc
tgcctcctcgcgctcatcgagggcgccggcctcatgctcaaccgcgtcctcgccgcgccg
cagaacctcccgccgctccccaccgacgaccccaacctggccgccgcgatggcgggggga
ggcgtcggcggcttcccaggcatgccccagccacccgtgccccctgtggaggtcgtgagc
tccagcggcgggggtagttggttcggcggcctcttcggcaagaaggaggaggagaagaag
cccagcggcagcggcggcaagtcggagatattagagagctttgatacgcccagccctccg
ataccatcgttcgacttgaagtga

DBGET integrated database retrieval system