Triticum dicoccoides (wild emmer wheat): 119366182 Help Entry 119366182         CDS       T07278                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03018   RNA degradation tdc03040   Spliceosome Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     119366182   09123 Folding, sorting and degradation    03018 RNA degradation     119366182  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tdc03019]     119366182    03041 Spliceosome [BR:tdc03041]     119366182 Messenger RNA biogenesis [BR:tdc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      119366182   mRNA degradation factors    5'-3' decay     Lsm complex      119366182 Spliceosome [BR:tdc03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     119366182 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  119366182 NCBI-ProteinID:  XP_037487773 LinkDB All DBs Position 2B:770857885..770860000 Genome browser AA seq 100 aa AA seqDB search MAGRKETALDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVESEREQDDPLKL STKTRQLGLIVCRGTAVMLVSPTDGTDEIANPFLAAEGAS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcgggccgcaaggagacggcgctggacctggccaagttcgtcgacaagggcgtccag gtcaagctcaccggcggccgccaagttacaggaaccttgaagggatatgaccagctgctc aacttagtgctggatgaagcagtcgagtctgaaagagagcaagatgacccattgaagctg tcaaccaagaccagacaacttggtctcattgtgtgcagaggcactgctgtcatgctggtg tcaccaactgatggaaccgacgagattgccaaccccttcctcgcagcggagggggcgtca taa

DBGET integrated database retrieval system