Tessaracoccus defluvii: H9L22_06270 Help Entry H9L22_06270       CDS       T06774                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tdf  Tessaracoccus defluvii Pathway tdf01100   Metabolic pathways tdf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tdf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L22_06270    00074 Mycolic acid biosynthesis     H9L22_06270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L22_06270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF5783 Motif Other DBs NCBI-ProteinID:  QNP56935 UniProt:  A0A7H0H8R9 LinkDB All DBs Position 1300956..1301201 Genome browser AA seq 81 aa AA seqDB search MASTEEIRTDLAEIVNDIAGVAAEDVQLDKSFVDDLGVDSLSMVEIIYACEDKFSVSIPD EDAKNLKTVGDAVAYIERAQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcaagcaccgaagagatccgcaccgacctcgccgagatcgtcaacgacatcgccggc gtagccgccgaggacgtccagctggacaagtccttcgtcgacgacctgggcgtcgactcc ctgtcgatggtcgagatcatctacgcctgcgaggacaagttctccgtgtcgatccccgac gaggacgccaagaacctcaagaccgtcggcgacgccgtcgcctacatcgagcgcgcccag agctga

DBGET integrated database retrieval system