Tenacibaculum dicentrarchi: AUW17_00015 Help Entry AUW17_00015       CDS       T04208                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism tdi  Tenacibaculum dicentrarchi Pathway tdi03060   Protein export tdi03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tdi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AUW17_00015  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AUW17_00015  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tdi02044]     AUW17_00015 Secretion system [BR:tdi02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AUW17_00015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALU73776 LinkDB All DBs Position 4041..4265 Genome browser AA seq 74 aa AA seqDB search MISLSIFLGMIGPLQIALVVGLALLMFGGKKIPELMKGLGTGIKEFKDATKAEEEVDEKG EKTEEIKTSSNDKK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgatttcacttagtatatttttaggaatgattggaccattgcaaatagccttggtagtt ggattagcattattaatgtttggaggaaagaaaattccagaattaatgaaaggtttaggt acaggaatcaaagaatttaaagatgccactaaagccgaggaagaagtagacgaaaaaggt gaaaaaacagaagaaattaaaacttcttctaacgataaaaaataa

DBGET integrated database retrieval system