Torulaspora delbrueckii: TDEL_0A01420 Help Entry TDEL_0A01420      CDS       T02236                                  Symbol TDEL0A01420 Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tdl  Torulaspora delbrueckii Pathway tdl03060   Protein export tdl04141   Protein processing in endoplasmic reticulum tdl04145   Phagosome Brite KEGG Orthology (KO) [BR:tdl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TDEL_0A01420 (TDEL0A01420)    04141 Protein processing in endoplasmic reticulum     TDEL_0A01420 (TDEL0A01420)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TDEL_0A01420 (TDEL0A01420)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdl04131]     TDEL_0A01420 (TDEL0A01420)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tdl02044]     TDEL_0A01420 (TDEL0A01420) Membrane trafficking [BR:tdl04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TDEL_0A01420 (TDEL0A01420) Secretion system [BR:tdl02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TDEL_0A01420 (TDEL0A01420) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  11502943 NCBI-ProteinID:  XP_003678685 UniProt:  G8ZLI0 LinkDB All DBs Position 1:258647..258877 Genome browser AA seq 76 aa AA seqDB search MARINEKSQGASQIEKLTDAPLEFVKEGQQFLAKCKKPDVKEYTKIVRAVGIGFVAVGVI GYAIKLVHIPIRYLIV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggccaggattaacgagaaaagtcaaggcgctagtcagatcgagaaactaacagacgct cctttggagtttgtcaaagaaggtcaacaatttttggccaaatgtaagaaaccagacgtt aaggagtacacgaagatcgtgcgtgcggttggaatcggtttcgtggctgtcggtgtgatt ggctacgctatcaaacttgtgcacatcccaatcagatatttgatcgtctaa

DBGET integrated database retrieval system