Sulfurimonas denitrificans: Suden_0458
Help
Entry
Suden_0458 CDS
T00298
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
tdn
Sulfurimonas denitrificans
Brite
KEGG Orthology (KO) [BR:
tdn00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
Suden_0458
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
ABB43739
UniProt:
Q30TE2
LinkDB
All DBs
Position
complement(461343..461642)
Genome browser
AA seq
99 aa
AA seq
DB search
MATNIDLETKEKVKIKYPKKYKVLLLNDDYTSMEFVIDILITIFHKNYEQAHQIMLEIHK
KTKGICGIYTYEIAETKVMQVHKKARDNGFALRATMEEE
NT seq
300 nt
NT seq
+upstream
nt +downstream
nt
atggcaacaaatatcgatttagaaactaaagagaaggtgaagataaagtacccaaaaaag
tataaagtgcttctcttaaatgatgactatacctctatggagtttgttatagatatttta
ataactatatttcataaaaattacgaacaggcgcatcaaataatgcttgagatacataaa
aaaacaaaaggaatctgcggaatatatacttatgaaattgcagagacaaaagttatgcag
gtacacaaaaaagctagagacaatggctttgcactaagagcaacaatggaggaggagtaa
DBGET
integrated database retrieval system