Triplophysa dalaica: 130410225 Help Entry 130410225         CDS       T09616                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism tdw  Triplophysa dalaica Pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04144   Endocytosis tdw04145   Phagosome tdw04148   Efferocytosis tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130410225 (rab7a)    04145 Phagosome     130410225 (rab7a)    04140 Autophagy - animal     130410225 (rab7a)    04137 Mitophagy - animal     130410225 (rab7a)    04148 Efferocytosis     130410225 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130410225 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130410225 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130410225 (rab7a)    04031 GTP-binding proteins [BR:tdw04031]     130410225 (rab7a) Membrane trafficking [BR:tdw04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130410225 (rab7a) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130410225 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    130410225 (rab7a)   Exosomal proteins of colorectal cancer cells    130410225 (rab7a)   Exosomal proteins of bladder cancer cells    130410225 (rab7a) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130410225 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NB-ARC NACHT AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  130410225 NCBI-ProteinID:  XP_056590776 LinkDB All DBs Position 21:11420841..11428853 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPIAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttctactcaaggtgatcatccttggagactccggggtcggg aagacgtctctgatgaaccaatatgtgaataagaagttcagtaatcagtataaagctact ataggtgcagatttcttgacaaaagaagtgatggtggatgaccgacttgtcacaatgcag atatgggacacagctggtcaggagaggttccagtcgctgggtgtggctttttaccgcggc gccgactgctgcgtgttggtgtttgacgtcactgcccccaacacctttaagacattggac agctggagggacgagttcctcatccaggccagtccgcgtgacccagaaaactttccattc gtggtgctgggcaacaaaattgatctggagaataggcaggtaacaaccaagcgagcacag gcttggtgtcagagtaagaacaatatcccgtactttgagaccagtgcaaaggaagccatc aacgtagagcaggcttttcaaaccatcgcacgcaacgcactcaaacaggaaaccgaagtg gagttatacaatgagttccccgagccaatcaaactagaccggaacgatagagccaaacca atagcagagtcttgtagctgctga

DBGET integrated database retrieval system