Triplophysa dalaica: 130410358 Help Entry 130410358         CDS       T09616                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism tdw  Triplophysa dalaica Pathway tdw04814   Motor proteins tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     130410358 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130410358 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tdw03037]     130410358 (dynlt3)    04812 Cytoskeleton proteins [BR:tdw04812]     130410358 (dynlt3) Cilium and associated proteins [BR:tdw03037]  Motile cilia and associated proteins   Dynein arm    130410358 (dynlt3) Cytoskeleton proteins [BR:tdw04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      130410358 (dynlt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  130410358 NCBI-ProteinID:  XP_056590955 LinkDB All DBs Position 21:complement(5997600..6000457) Genome browser AA seq 115 aa AA seqDB search MEEYHPGDEVSFNPDDASNVIKECIEGIIGGVDYSQNKVNQWTASIVEHSLTQLVKQGKP FKFIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCVVSVFAVAIVL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggaatatcatcctggagacgaggtgtctttcaatccagatgatgcaagtaatgtt attaaagagtgcattgagggtatcattgggggtgtggactacagccagaacaaagtgaac cagtggacggccagcatagtcgaacactctctcactcagttagttaaacaggggaaacct ttcaagttcatagtcaactgtgctgtgatgcagaaaagcggcgcaggtcttcacacagcc aactcttgttactgggacactactactgacggaagctgcacggttaggtgggagaaccgt accatgtactgtgttgtcagtgtgtttgctgtggctattgtcctataa

DBGET integrated database retrieval system