Triplophysa dalaica: 130411344 Help Entry 130411344         CDS       T09616                                  Symbol zgc:100918 Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism tdw  Triplophysa dalaica Pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04144   Endocytosis tdw04145   Phagosome tdw04148   Efferocytosis tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130411344 (zgc:100918)    04145 Phagosome     130411344 (zgc:100918)    04140 Autophagy - animal     130411344 (zgc:100918)    04137 Mitophagy - animal     130411344 (zgc:100918)    04148 Efferocytosis     130411344 (zgc:100918)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130411344 (zgc:100918)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130411344 (zgc:100918)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130411344 (zgc:100918)    04031 GTP-binding proteins [BR:tdw04031]     130411344 (zgc:100918) Membrane trafficking [BR:tdw04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130411344 (zgc:100918) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130411344 (zgc:100918)   Exosomal proteins of other body fluids (saliva and urine)    130411344 (zgc:100918)   Exosomal proteins of colorectal cancer cells    130411344 (zgc:100918)   Exosomal proteins of bladder cancer cells    130411344 (zgc:100918) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130411344 (zgc:100918) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 nSTAND3 PduV-EutP Septin AAA_16 NTPase_1 AAA_22 AAA_7 AAA_24 G-alpha AAA_5 SRPRB ATPase_2 DUF5992 NB-ARC ABC_tran NACHT AAA_14 ATP-synt_ab DAP3 Motif Other DBs NCBI-GeneID:  130411344 NCBI-ProteinID:  XP_056591871 LinkDB All DBs Position 22:18822820..18825278 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSDIPYFETSAKEAINVDQAFQTIARNALKQESDV ETYDFPDQIKLRNEGTVSSGDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaaaaaggttctcctgaaggtgattattcttggggattctggtgttgga aagacttcgctgatgaaccaatatgtcaataagaaattcagcaatcagtataaagccacg atcggtgctgactttcttaccaaggaagtgatggtggatgacaggctggtgacaatgcag atttgggacacagcaggacaggagcggtttcagtctttgggcgtggctttttatcgtgga gcggactgctgcgtgctggtgtacgatgtgactgcgccaaacaccttcaaaaccctggac agctggagggatgagttcctcatacaggccagcccacgcgacccagagaacttccctttt gtagtgcttggcaacaagatcgatttggagaacagacaggtgactacaaagcgggcacag gcgtggtgtcagagcaaaagtgacattccatactttgaaaccagtgcaaaagaggccatc aacgtggaccaggctttccaaaccatcgctcgtaatgcccttaaacaggagtctgatgtg gagacgtatgacttcccggaccagattaaactgcgaaatgagggaaccgtgtcctccggc gatggctgcagctgctga

DBGET integrated database retrieval system