Triplophysa dalaica: 130414027 Help Entry 130414027         CDS       T09616                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism tdw  Triplophysa dalaica Pathway tdw04010   MAPK signaling pathway tdw04012   ErbB signaling pathway tdw04068   FoxO signaling pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04144   Endocytosis tdw04150   mTOR signaling pathway tdw04210   Apoptosis tdw04218   Cellular senescence tdw04370   VEGF signaling pathway tdw04371   Apelin signaling pathway tdw04510   Focal adhesion tdw04540   Gap junction tdw04625   C-type lectin receptor signaling pathway tdw04810   Regulation of actin cytoskeleton tdw04910   Insulin signaling pathway tdw04912   GnRH signaling pathway tdw04916   Melanogenesis tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130414027 (hrasa)    04012 ErbB signaling pathway     130414027 (hrasa)    04370 VEGF signaling pathway     130414027 (hrasa)    04371 Apelin signaling pathway     130414027 (hrasa)    04068 FoxO signaling pathway     130414027 (hrasa)    04150 mTOR signaling pathway     130414027 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130414027 (hrasa)    04140 Autophagy - animal     130414027 (hrasa)    04137 Mitophagy - animal     130414027 (hrasa)   09143 Cell growth and death    04210 Apoptosis     130414027 (hrasa)    04218 Cellular senescence     130414027 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130414027 (hrasa)    04540 Gap junction     130414027 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130414027 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130414027 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     130414027 (hrasa)    04912 GnRH signaling pathway     130414027 (hrasa)    04916 Melanogenesis     130414027 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130414027 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130414027 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130414027 (hrasa)    04031 GTP-binding proteins [BR:tdw04031]     130414027 (hrasa) Membrane trafficking [BR:tdw04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130414027 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     130414027 (hrasa) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    130414027 (hrasa)   Exosomal proteins of colorectal cancer cells    130414027 (hrasa) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130414027 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  130414027 NCBI-ProteinID:  XP_056595616 LinkDB All DBs Position 24:11592425..11609865 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDDSGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaactggtggtggtgggtgctggtggcgtgggcaagagcgcactcacc atccaactcatccagaaccactttgtggatgaatacgacccaaccatagaggactcctac aggaagcaggtggtgatcgatggagagacgtgtctacttgacatcttggacactgcaggt caggaggagtacagcgctatgagagaccagtacatgaggacgggagagggcttcctctgc gtctttgccatcaataacacaaagtcctttgaggacattcatcaatacagggaacagatc aagagggtaaaggactcggatgatgtgcccatggtgcttgtgggtaacaagtgtgacctc ccagctcggacggtggacacgcggcaagcccaggagctcgcgcgaagctacgggatccca ttcatcgagacctccgccaaaaccagacagggcgtagaggacgccttttataccctcgta cgagagatccggcagcacaaaatgaggaagctgaaccctccggacgacagcggtcaggac tgcatgagctgccgctgcgttgtgtcatga

DBGET integrated database retrieval system