Triplophysa dalaica: 130419090 Help Entry 130419090         CDS       T09616                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism tdw  Triplophysa dalaica Pathway tdw04010   MAPK signaling pathway tdw04068   FoxO signaling pathway tdw04081   Hormone signaling tdw04114   Oocyte meiosis tdw04140   Autophagy - animal tdw04150   mTOR signaling pathway tdw04810   Regulation of actin cytoskeleton tdw04910   Insulin signaling pathway tdw04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130419090 (ins)    04068 FoxO signaling pathway     130419090 (ins)    04150 mTOR signaling pathway     130419090 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     130419090 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130419090 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     130419090 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130419090 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     130419090 (ins)    04914 Progesterone-mediated oocyte maturation     130419090 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tdw04052]     130419090 (ins) Cytokines and neuropeptides [BR:tdw04052]  Neuropeptides   Unclassified    130419090 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Toxin_8 Motif Other DBs NCBI-GeneID:  130419090 NCBI-ProteinID:  XP_056601498 LinkDB All DBs Position 4:23305737..23307435 Genome browser AA seq 133 aa AA seqDB search MQIVPNHLTSVICNHLVLGFKNRVIMALWLQAGALMMILAISGVNANAGAAQHLCGSHLV DALYLVCGPTGFFYNPKRDVDPLMGFLPPKSDQENEAADFAFKDHAELIRKRGIVEQCCH KPCSIFELQNYCN NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcagatcgtcccaaaccatctcacctctgtcatctgtaaccatctagtcctcggcttc aagaacagggtaataatggcattgtggctccaagctggtgctctcatgatgattttggcc atctctggtgtcaacgctaatgcaggggctgcccagcacctgtgtggctctcacctagtc gatgcactttacctagtctgtggtccaacaggctttttctacaaccctaagagagatgtt gaccccctaatgggtttccttcctcctaaatccgaccaggaaaatgaggcggctgacttt gcattcaaagatcatgctgagctgataagaaagagaggcatagtggagcagtgctgccac aaaccctgcagcatcttcgaactccagaattactgcaattaa

DBGET integrated database retrieval system