Triplophysa dalaica: 130419842 Help Entry 130419842         CDS       T09616                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism tdw  Triplophysa dalaica Pathway tdw04010   MAPK signaling pathway tdw04012   ErbB signaling pathway tdw04068   FoxO signaling pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04144   Endocytosis tdw04150   mTOR signaling pathway tdw04210   Apoptosis tdw04218   Cellular senescence tdw04370   VEGF signaling pathway tdw04371   Apelin signaling pathway tdw04510   Focal adhesion tdw04540   Gap junction tdw04625   C-type lectin receptor signaling pathway tdw04810   Regulation of actin cytoskeleton tdw04910   Insulin signaling pathway tdw04912   GnRH signaling pathway tdw04916   Melanogenesis tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130419842 (hrasb)    04012 ErbB signaling pathway     130419842 (hrasb)    04370 VEGF signaling pathway     130419842 (hrasb)    04371 Apelin signaling pathway     130419842 (hrasb)    04068 FoxO signaling pathway     130419842 (hrasb)    04150 mTOR signaling pathway     130419842 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130419842 (hrasb)    04140 Autophagy - animal     130419842 (hrasb)    04137 Mitophagy - animal     130419842 (hrasb)   09143 Cell growth and death    04210 Apoptosis     130419842 (hrasb)    04218 Cellular senescence     130419842 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130419842 (hrasb)    04540 Gap junction     130419842 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130419842 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130419842 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     130419842 (hrasb)    04912 GnRH signaling pathway     130419842 (hrasb)    04916 Melanogenesis     130419842 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130419842 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130419842 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130419842 (hrasb)    04031 GTP-binding proteins [BR:tdw04031]     130419842 (hrasb) Membrane trafficking [BR:tdw04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130419842 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     130419842 (hrasb) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    130419842 (hrasb)   Exosomal proteins of colorectal cancer cells    130419842 (hrasb) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130419842 (hrasb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  130419842 NCBI-ProteinID:  XP_056602797 LinkDB All DBs Position 1:11103210..11164861 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataaattagtggtggtgggtgcaggtggtgtgggcaagagtgctttgacc atccaactcattcagaatcactttgttgatgaatacgacccaaccattgaggactcatac aggaagcaggtggtgattgatggagaaacgtgtcttttggatatcctggacactgcaggt caggaggagtacagtgcaatgagagaccaatacatgaggactggagaaggttttctttgt gtctttgccatcaacaataccaagtctttcgaggacattcatcagtacagggaacagatt aagagggtgaaagactctgatgatgtgcctatggtgcttgtgggtaataaatgtgatcta ccagcccgcactgtggacacaagacaagcccaggaacttgcccgtagctatggtatacca tacattgaaacctcagctaaaactagacagggagtggaagatgctttttacacacttgtc cgtgaaattaggcaacacaagctgaggaaactgaaccctccagatgacaatggccaagac tgcatgaattgccgctgtgtggtgtcatga

DBGET integrated database retrieval system