Triplophysa dalaica: 130427426 Help Entry 130427426         CDS       T09616                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism tdw  Triplophysa dalaica Pathway tdw04060   Cytokine-cytokine receptor interaction tdw04218   Cellular senescence tdw04620   Toll-like receptor signaling pathway tdw04621   NOD-like receptor signaling pathway tdw04622   RIG-I-like receptor signaling pathway tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130427426  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     130427426  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130427426    04621 NOD-like receptor signaling pathway     130427426    04622 RIG-I-like receptor signaling pathway     130427426  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130427426  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tdw04052]     130427426    00536 Glycosaminoglycan binding proteins [BR:tdw00536]     130427426 Cytokines and neuropeptides [BR:tdw04052]  Cytokines   Chemokines    130427426 Glycosaminoglycan binding proteins [BR:tdw00536]  Heparan sulfate / Heparin   Chemokines    130427426 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  130427426 NCBI-ProteinID:  XP_056610883 LinkDB All DBs Position 1:29778599..29780142 Genome browser AA seq 99 aa AA seqDB search MKFFLMLMLIGASMLFSKALQPFGPGYNRHCMCVKLESRVIPPDNLQSVEILPRGHHCKT TEVIAGLSSGEKICLNPRTPWVRKLINFIEKKERSNKKE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaagttcttcctgatgttaatgttgattggagccagcatgcttttctccaaagcgctg cagcctttcggcccaggttacaacagacactgcatgtgtgtgaaactcgagtcgagggta atcccaccagataacttgcaaagtgtggagatcttgcccagaggtcatcactgtaagact acagaggtcattgccggtttatcaagtggagagaagatctgccttaaccccaggacacca tgggttagaaaactcattaactttattgagaaaaaagaaagaagcaacaagaaagagtaa

DBGET integrated database retrieval system