Triplophysa dalaica: 130429066 Help Entry 130429066         CDS       T09616                                  Name (RefSeq) C-X-C motif chemokine 10-like   KO K10030   interleukin 8 Organism tdw  Triplophysa dalaica Pathway tdw04060   Cytokine-cytokine receptor interaction tdw04218   Cellular senescence tdw04620   Toll-like receptor signaling pathway tdw04621   NOD-like receptor signaling pathway tdw04622   RIG-I-like receptor signaling pathway tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130429066  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     130429066  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130429066    04621 NOD-like receptor signaling pathway     130429066    04622 RIG-I-like receptor signaling pathway     130429066  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130429066  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tdw04052]     130429066    00536 Glycosaminoglycan binding proteins [BR:tdw00536]     130429066 Cytokines and neuropeptides [BR:tdw04052]  Cytokines   Chemokines    130429066 Glycosaminoglycan binding proteins [BR:tdw00536]  Heparan sulfate / Heparin   Chemokines    130429066 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Gp_UL130 DELLA Motif Other DBs NCBI-GeneID:  130429066 NCBI-ProteinID:  XP_056613416 LinkDB All DBs Position 1:29772078..29773565 Genome browser AA seq 107 aa AA seqDB search MKTFTVVALTFLICMMVFCTTEGRPQLRCQCIRTYSGNPISIKRVDSIKIFPAGPHCKNE EIIATMKKKHSTTCLNPSDAWVKSLIEELNKKSNSIKAARIEKHLAY NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaaacattcactgtagtagccctgactttcctgatctgcatgatggtgttctgtaca acagaaggtagaccacaacttcgatgccagtgtattagaacatattcaggaaatcccatt tctatcaaaagagtagattcaataaagatatttcctgctggtccgcattgcaaaaatgag gagatcatagccacaatgaagaaaaaacatagcacaacctgtctgaatcccagtgatgcc tgggtgaaatctctcattgaagaattgaacaagaaatcaaacagtataaaggcagcaaga atcgaaaaacatcttgcttactaa

DBGET integrated database retrieval system