Triplophysa dalaica: 130432490 Help Entry 130432490         CDS       T09616                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism tdw  Triplophysa dalaica Pathway tdw04010   MAPK signaling pathway tdw04144   Endocytosis tdw04370   VEGF signaling pathway tdw04510   Focal adhesion tdw04520   Adherens junction tdw04530   Tight junction tdw04810   Regulation of actin cytoskeleton tdw04912   GnRH signaling pathway tdw05100   Bacterial invasion of epithelial cells tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130432490 (cdc42l)    04370 VEGF signaling pathway     130432490 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130432490 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130432490 (cdc42l)    04520 Adherens junction     130432490 (cdc42l)    04530 Tight junction     130432490 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130432490 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     130432490 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130432490 (cdc42l)    05100 Bacterial invasion of epithelial cells     130432490 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130432490 (cdc42l)    03036 Chromosome and associated proteins [BR:tdw03036]     130432490 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130432490 (cdc42l)    04031 GTP-binding proteins [BR:tdw04031]     130432490 (cdc42l) Membrane trafficking [BR:tdw04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130432490 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     130432490 (cdc42l)   Macropinocytosis    Ras GTPases     130432490 (cdc42l) Chromosome and associated proteins [BR:tdw03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     130432490 (cdc42l) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of microglial cells    130432490 (cdc42l)   Exosomal proteins of breast milk    130432490 (cdc42l) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130432490 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  130432490 NCBI-ProteinID:  XP_056617843 LinkDB All DBs Position 12:4440268..4445702 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggtgatggagctgttggaaagacctgcctcctc atctcctacacgaccaacaaattcccatctgaatatgttcccacggtgtttgataactat gccgtaacagtgatgatcggaggcgaaccatatacattggggctttttgacactgcaggt caggaagactacgacagacttcggcctctcagctatccgcagacagacgtcttcctggtt tgcttctctgtcgtttctccttcctcctttgagaacgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttctggtgggcactcaagtcgatctgagg gacgacagtaacactgtggaaaaacttgccaaaaacaagcagcgccccatatcgcccgaa agtggggagaagctggccagagacctcagagctgtgaaatatgtagagtgctccgccctc acgcagagaggcttgaagaatgtattcgacgaggcgatacttgccgcgcttgaacctccc gagacgaaaccgaagaaacgctgcatcctcttgtag

DBGET integrated database retrieval system