Triplophysa dalaica: 130432862 Help Entry 130432862         CDS       T09616                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism tdw  Triplophysa dalaica Pathway tdw04382   Cornified envelope formation tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     130432862 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130432862 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130432862 (s100a10b) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of microglial cells    130432862 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 EH Motif Other DBs NCBI-GeneID:  130432862 NCBI-ProteinID:  XP_056618405 LinkDB All DBs Position 12:complement(7787041..7788553) Genome browser AA seq 103 aa AA seqDB search MPSDLERAMETLITVFHRYAGREGNKASLSRKELKQLMETELSSFLKSQKDPAAIDKIMK DLDANGDGEVNFEEFVSLVVGLSIACEQIYQTHQKLTAGVKKQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcgatggagactctgatcactgtgtttcaccgttacgcg ggcagagagggtaataaagcatcgctgagccgcaaagaactcaaacagctgatggagaca gagctgtccagctttttgaagtctcaaaaggatcctgctgcaatagacaagattatgaag gatctggacgctaatggcgacggagaggtgaatttcgaggagtttgtttctcttgtggtc ggtttgtccattgcttgcgaacagatctaccagacgcaccagaaactgacagcaggtgtt aaaaagcaataa

DBGET integrated database retrieval system