Triplophysa dalaica: 130435736 Help Entry 130435736         CDS       T09616                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism tdw  Triplophysa dalaica Brite KEGG Orthology (KO) [BR:tdw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tdw03019]     130435736 (mt2)    03029 Mitochondrial biogenesis [BR:tdw03029]     130435736 (mt2) Messenger RNA biogenesis [BR:tdw03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      130435736 (mt2) Mitochondrial biogenesis [BR:tdw03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     130435736 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  130435736 NCBI-ProteinID:  XP_056622525 LinkDB All DBs Position 14:6982850..6983587 Genome browser AA seq 60 aa AA seqDB search MDPCDCSKSGTCNCGATCKCTNCKCTTCKKSCCSCCPSGCSKCASGCVCKDNSCDPSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgtgattgctcaaagtctggaacttgcaactgcggtgccacctgcaagtgt accaactgcaagtgtacaacctgcaagaagagttgctgttcttgctgcccatctggctgc agtaagtgcgcctctggctgcgtatgtaaggacaattcctgtgaccccagctgttgtcaa tga

DBGET integrated database retrieval system