Triplophysa dalaica: 130439916 Help Entry 130439916         CDS       T09616                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism tdw  Triplophysa dalaica Pathway tdw04010   MAPK signaling pathway tdw04012   ErbB signaling pathway tdw04068   FoxO signaling pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04150   mTOR signaling pathway tdw04210   Apoptosis tdw04218   Cellular senescence tdw04370   VEGF signaling pathway tdw04371   Apelin signaling pathway tdw04540   Gap junction tdw04625   C-type lectin receptor signaling pathway tdw04810   Regulation of actin cytoskeleton tdw04910   Insulin signaling pathway tdw04912   GnRH signaling pathway tdw04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130439916 (nras)    04012 ErbB signaling pathway     130439916 (nras)    04370 VEGF signaling pathway     130439916 (nras)    04371 Apelin signaling pathway     130439916 (nras)    04068 FoxO signaling pathway     130439916 (nras)    04150 mTOR signaling pathway     130439916 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130439916 (nras)    04137 Mitophagy - animal     130439916 (nras)   09143 Cell growth and death    04210 Apoptosis     130439916 (nras)    04218 Cellular senescence     130439916 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     130439916 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130439916 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130439916 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     130439916 (nras)    04912 GnRH signaling pathway     130439916 (nras)    04916 Melanogenesis     130439916 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130439916 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130439916 (nras)    04031 GTP-binding proteins [BR:tdw04031]     130439916 (nras) Membrane trafficking [BR:tdw04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130439916 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     130439916 (nras) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130439916 (nras)   Exosomal proteins of other body fluids (saliva and urine)    130439916 (nras)   Exosomal proteins of breast cancer cells    130439916 (nras)   Exosomal proteins of colorectal cancer cells    130439916 (nras) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130439916 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  130439916 NCBI-ProteinID:  XP_056628563 LinkDB All DBs Position 18:complement(3663109..3667569) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLDSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggttgttgtgggagcaggtggtgtcgggaaaagcgctttaacc atccagctcattcagaatcactttgtggacgaatatgaccccaccattgaggactcttac aggaagcaggtggtgattgatggcgagacgtgtctgctggacatcctggacactgccggt caggaggagtacagcgctatgcgagaccagtacatgaggacgggagagggcttcttatgc gtctttgctataaacaacagcaaatccttcgctgatgtgcacttgtacagagagcagatc aagcgagttaaggactctgatgacgttccgatggttctagtggggaacaagtgtgatttg gctagaacggtggacaccaaacaggctcaggaacttgccagaagttacggcatagagttt gtggaaacttcagccaagactagacagggagtcgaagacgctttttacaccctcgttcgt gagatccggcattatcgcatgaaaaagctcgacagcagagaggacaggaagcagggctgc ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system