Triplophysa dalaica: 130440192 Help Entry 130440192         CDS       T09616                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism tdw  Triplophysa dalaica Pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04144   Endocytosis tdw04145   Phagosome tdw04148   Efferocytosis tdw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tdw00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130440192 (rab7b)    04145 Phagosome     130440192 (rab7b)    04140 Autophagy - animal     130440192 (rab7b)    04137 Mitophagy - animal     130440192 (rab7b)    04148 Efferocytosis     130440192 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130440192 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130440192 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130440192 (rab7b)    04031 GTP-binding proteins [BR:tdw04031]     130440192 (rab7b) Membrane trafficking [BR:tdw04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130440192 (rab7b) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130440192 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    130440192 (rab7b)   Exosomal proteins of colorectal cancer cells    130440192 (rab7b)   Exosomal proteins of bladder cancer cells    130440192 (rab7b) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130440192 (rab7b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 AAA_16 NTPase_1 AAA_24 AAA_22 G-alpha ATPase_2 AAA_5 AAA_14 ATP-synt_ab ABC_tran NACHT SRPRB MCM Motif Other DBs NCBI-GeneID:  130440192 NCBI-ProteinID:  XP_056629130 LinkDB All DBs Position 18:complement(18653152..18662356) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTVPTTFKTLESWRDEFLIQASPRDPENFPF VVLGNKIDMENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQESEG ETYDFPDPIKLRNDGPTSASDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttcccgcaagaaagtgctgcttaaagtgatcatcctaggggattctggagttggc aagacctctttgatgaatcaatatgtgaataataaatttagtaatcagtataaggccact attggagctgacttcctcaccaaggaggtgatggtggatgacaggctggtcaccatgcag atttgggatacagctggtcaggagcgatttcagtctctgggcgtggctttctacagaggg gcggactgttgtgtgctggtgtatgacgtcacggtgccaactacatttaagactctggaa agctggagggatgagtttctcattcaggccagtccacgagacccagagaacttccccttt gttgtactgggcaacaaaattgacatggagaaccgacaggtaacaaccaagcgagctcaa gcgtggtgtcagagtaaaaacaatatcccctattttgagacgagtgccaaagaagctatt aatgtggagcaggccttccaaacaatcgctcgtaatgccctcaaacaggagtcagaaggg gagacatatgattttcctgacccgattaaattaagaaatgatggacctacatctgctagt gatggctgcagttgctga

DBGET integrated database retrieval system